A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10120
Swiss-prot Accession number	Q8HZR9 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Ailurus fulgens (Lesser panda) (Red panda)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ailuridae;Ailurus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	15067
References	1   Liao M.J., Zhu M.Y., Zhang A.J.; "The lesser panda luteinizing hormone beta subunit."; Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCRPINATLAAENEACPVCVTFTTTICAGYCPSMVRVLPAILPPMPQPVCTYHELHFASIRLPGCPPGVDPMVSFPVALSCRCGPCRLSNSDCGGPRAQPLACDRPPLPGLLFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10211
Swiss-prot Accession number	Q8HZS0 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha).
Source organism	Ailurus fulgens (Lesser panda) (Red panda)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ailuridae;Ailurus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	120 Amino acids
Molecular weight	13485
References	1   Liao M.J., Zhu M.Y., Zhang A.J.; "The lesser panda glycoprotein hormone common alpha subunit."; Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases. 2   Liao M.J., Zhu M.Y., Zhang A.J.; "The lesser panda glycoprotein hormone common alpha subunit."; Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	FPDGEFTMQGCPECKLKENKYFSKLGAPIFQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS
Position of mature hormone in Pre-Hormone protein	96 Residues from position (25-120)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated